Protein Info for LRK55_RS00865 in Rhodanobacter denitrificans MT42

Annotation: NADH-quinone oxidoreductase subunit NuoI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01971: NADH-quinone oxidoreductase, chain I
  • amino acids 19 to 141 (123 residues), 142.6 bits, E=2.1e-46
• PF00037: Fer4
  • amino acids 60 to 79 (20 residues), 24.2 bits, see alignment (E = 1.1e-08)
  • amino acids 96 to 118 (23 residues), 29.1 bits, 3.1e-10
• PF13237: Fer4_10
  • amino acids 60 to 114 (55 residues), 30 bits, E=2.1e-10
• PF12800: Fer4_4
  • amino acids 61 to 75 (15 residues), 17.2 bits, see alignment (E = 2.6e-06)
  • amino acids 102 to 115 (14 residues), 13.4 bits, see alignment (E = 4.3e-05)
• PF13187: Fer4_9
  • amino acids 62 to 116 (55 residues), 37.7 bits, E=8.5e-13
• PF12838: Fer4_7
  • amino acids 62 to 116 (55 residues), 45.1 bits, E=5.6e-15

Best Hits

Swiss-Prot: 77% identical to NUOI_XANCP: NADH-quinone oxidoreductase subunit I (nuoI) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K00338, NADH dehydrogenase I subunit I [EC: 1.6.5.3] (inferred from 78% identity to sml:Smlt3397)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain I (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

• NADH to cytochrome bd oxidase electron transfer I (2/2 steps found)
• aerobic respiration I (cytochrome c) (3/4 steps found)
• aerobic respiration III (alternative oxidase pathway) (2/3 steps found)
• NADH to cytochrome bo oxidase electron transfer I (1/2 steps found)
• NAD(P)/NADPH interconversion (3/6 steps found)
• Fe(II) oxidation (2/6 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Protein Sequence (163 amino acids)

>LRK55_RS00865 NADH-quinone oxidoreductase subunit NuoI (Rhodanobacter denitrificans MT42)
MNRVTGYFKSLLLVELFQGMGVTLRYLFKPKYTMRYPMEHIPKSNRFRGLHALRRYANGE
ERCIACKLCEAVCPALAITIDSAPRESDGQRRTTRYEIDLFKCIFCGFCEESCPVDSIVE
TSIHEYHFENRGENVVDKQKLLAIGDRFEQQIAADRAQDAAYR