Protein Info for LRK54_RS18070 in Rhodanobacter denitrificans FW104-10B01

Annotation: FAD-binding oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01266: DAO
  • amino acids 30 to 381 (352 residues), 216.3 bits, E=2.7e-67
• PF00890: FAD_binding_2
  • amino acids 31 to 267 (237 residues), 37.4 bits, E=5.7e-13

Best Hits

KEGG orthology group: K09471, gamma-glutamylputrescine oxidase [EC: 1.4.3.-] (inferred from 60% identity to bge:BC1002_4375)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.3.-

Protein Sequence (429 amino acids)

>LRK54_RS18070 FAD-binding oxidoreductase (Rhodanobacter denitrificans FW104-10B01)
MKSPSPTSYYRATATPYPAWEPLQGSTHARVAVIGGGFAGLNTALGLAERGVRDVVLLER
EQVGFGASGRNGGFVFAGYSLGEQALLDQLGEARAQALFQLTTAAVGRIRRRVAEYAIPC
DAVDEGVIWANWFRDPAVLRRRQQLLAEHYHVNWQWLPEAELRARIRSERYHDGLYERDA
LHLHPLNYAIGLAAAAAGQGVRIHEHSGVRSLAREGRQWRLRTAQGELLADQVVLACGGY
LAGLRKPIDRAILPIATYVMVTEALGDRLDECLHTRAAIYDSRFAFDYYRALPDTRLLWG
GRISVLNRSPRGVQRLLTRDLLRVFPQLAGVRIEHAWSGLMSYARHQMPQIGGSDDGLWW
AQAFGGHGLAPTCAAGELLAAAIADGDDGWKRFADYGLGNTHRPFGYLAAQASYWWQQSR
DCLKTRLEG