Protein Info for LRK54_RS18010 in Rhodanobacter denitrificans FW104-10B01

Annotation: type B 50S ribosomal protein L36

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 41 TIGR01022: ribosomal protein bL36" amino acids 1 to 40 (40 residues), 33.8 bits, see alignment E=1.4e-12 PF00444: Ribosomal_L36" amino acids 1 to 40 (40 residues), 64.9 bits, see alignment E=2.8e-22

Best Hits

Swiss-Prot: 95% identical to RL36_STRMK: 50S ribosomal protein L36 (rpmJ) from Stenotrophomonas maltophilia (strain K279a)

KEGG orthology group: K02919, large subunit ribosomal protein L36 (inferred from 93% identity to xal:XALc_1604)

Predicted SEED Role

"LSU ribosomal protein L36p" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (41 amino acids)

>LRK54_RS18010 type B 50S ribosomal protein L36 (Rhodanobacter denitrificans FW104-10B01)
MKVLNSLKSAKARHRDCKVVRRRGKVFVICKSNPRFKARQR