Protein Info for LRK54_RS17950 in Rhodanobacter denitrificans FW104-10B01

Annotation: MASE1 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 530 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 51 to 72 (22 residues), see Phobius details amino acids 80 to 80 (1 residues), see Phobius details amino acids 85 to 96 (12 residues), see Phobius details amino acids 116 to 137 (22 residues), see Phobius details amino acids 156 to 173 (18 residues), see Phobius details amino acids 182 to 203 (22 residues), see Phobius details amino acids 210 to 227 (18 residues), see Phobius details amino acids 234 to 253 (20 residues), see Phobius details amino acids 259 to 278 (20 residues), see Phobius details PF05231: MASE1" amino acids 17 to 248 (232 residues), 58.4 bits, see alignment E=1e-19 PF07730: HisKA_3" amino acids 325 to 387 (63 residues), 30.8 bits, see alignment E=5.2e-11 PF02518: HATPase_c" amino acids 431 to 513 (83 residues), 27.2 bits, see alignment E=7e-10

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (530 amino acids)

>LRK54_RS17950 MASE1 domain-containing protein (Rhodanobacter denitrificans FW104-10B01)
MRLKPLRLPDSGPLLAAGYLLLWLLLWLTVQPYWMLPYGLRFGALLLTPVRYWGWLLGGE
LVATAGIGLAHGLPQGWLGFAIDELPEPLVMAAGLWLLRRFNLHASLHSPQEVTRLLLSV
VLVVTATTAVDAALLALVSTPGSPELIIGVLGEELLSHYLGILLIVPLMIMLLRTRIEQR
ALVSLFMDGLLVMLPSMTILLVLSEQAAPQPQFARVLSLAPVLFFAFRHGWRGASLAMLI
TSLGMTLADQHLGHAPSNAAAYLFLAVAGTGALMLGSATDALRRSSERVAEQNVYLGAVN
RRLDQLAHQLRDAARGNLQADENQRRHLAAELHDELGQNITAIQTHVKLAQARLLQAGME
DISTSINTILAHMRRALHRLLDDLRPAVLDEFGLLRALDEGPIRDLLNAAGMAYCTELHG
DPRLLDDDTRTAIYRLVQESATNAVKHAKASEFRLRLRIGERQGIAVALLDLRDDGTGLP
SRLPRGGRGLQGMRDRVTSLGGQFRLRPTPAGVHLRILLRGNNHFSENSR