Protein Info for LRK54_RS17530 in Rhodanobacter denitrificans FW104-10B01

Annotation: FTR1 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 620 transmembrane" amino acids 350 to 375 (26 residues), see Phobius details amino acids 387 to 409 (23 residues), see Phobius details amino acids 421 to 438 (18 residues), see Phobius details amino acids 464 to 490 (27 residues), see Phobius details amino acids 496 to 517 (22 residues), see Phobius details amino acids 528 to 550 (23 residues), see Phobius details amino acids 576 to 597 (22 residues), see Phobius details PF13442: Cytochrome_CBB3" amino acids 96 to 179 (84 residues), 42.7 bits, see alignment E=8.7e-15 PF00034: Cytochrom_C" amino acids 99 to 182 (84 residues), 41 bits, see alignment E=6e-14 PF03239: FTR1" amino acids 351 to 554 (204 residues), 98.2 bits, see alignment E=8.4e-32

Best Hits

KEGG orthology group: K07243, high-affinity iron transporter (inferred from 65% identity to gpb:HDN1F_30560)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (620 amino acids)

>LRK54_RS17530 FTR1 family protein (Rhodanobacter denitrificans FW104-10B01)
MIDYLATDYAGAVKNGAVLSASEYAEMREFTATVHRRLQALPPTPGTPALLSQADQLIAS
VDAKASPAQVAIEAHALADALLKAYPIPTAPAQAPDLTQGATLYQNQCAMCHGATGHGDG
PVGLQLNPRPVDFTDQARADQRSPLSLYEVISHGVEGTPMASYSSRLSSDERWALAYYVG
SLAYTREATTGATLWQHDTAARAQIADLKELSQARVSQLAPALGAEHARAIIGYLRAHPQ
AMQQALTGLPLARGRLAASLAAYRAGDAKEATQLALSAYLDGVEPIEPQLNARDGALRAR
IETAMGAYRTAVSGKAALPAVTQQAHAVDVLLAQAQEVTADAAGDPAATFLGAFTILVRE
GLEALLVVVALLAFLRKADRRVEVRYVHAGWILALVAGGITWALASYAISISGAGRELTE
GLSSLFAAVVLLSVGLWMHQKSIGGRWQAYLKEKMAAALDRRSAWFLFGLAFISVYREVF
ETILFYAALWNDGQEVWLLGGIAAGAVTLGLIAWLLLRTSRRLPIGKFFAASSILIAVLA
VVLAGKGIAALQEAGWVSVTVAPVPHIELLGIYPTWQTLLAQIAVVLMLSAGFMFNMLRG
RSAPDALPASTTTRPEEDRA