Protein Info for LRK54_RS17285 in Rhodanobacter denitrificans FW104-10B01

Annotation: NADH-quinone oxidoreductase subunit C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 514 PF00329: Complex1_30kDa" amino acids 22 to 138 (117 residues), 41.3 bits, see alignment E=2.2e-14 PF00346: Complex1_49kDa" amino acids 283 to 435 (153 residues), 97.9 bits, see alignment E=5.4e-32

Best Hits

KEGG orthology group: None (inferred from 57% identity to bph:Bphy_6069)

Predicted SEED Role

"Ni,Fe-hydrogenase III large subunit" in subsystem Hydrogenases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (514 amino acids)

>LRK54_RS17285 NADH-quinone oxidoreductase subunit C (Rhodanobacter denitrificans FW104-10B01)
MWPDFLDTESVPLPSNVAARRIQVDAARWCEAADAMREAGADLLSLWGSDDRDRDRCLRV
HAAYLLRDRVVVVEHAMPASQAIYPSLATRFPVAGRLQRATYDLLGIRADAGDTRPWLRH
GGWPEDVFPLRRDVAATQTWPVTSSPYPFVPVSGDGVHEMTAGPVHAGTIEPGRFQLAVV
GEKVLRLEVRLGYTHKGIAKRFEALAQRDAHRLAAHICGDSTVAFSWAYCAALESITAST
PSPRALVLRALALERERIANHLGDLGGLANDAGFAFGQTQFSSLKEQLLRHNAALFGQRY
LFDFVVPGGVARDLPARALPGMLDEIAALEHAVGDLRGIYARHAGLQDRFLGAGRLTPAQ
AAALGAIGLAGRASGVARDLRVDQPWSPYDHSSPTLATSTEGDVAARVQVRFDETLESLR
LCRQWLQALPAGERVCDVPVAPAGQLGIGLIEGWRGPVMLALETGPAGGIRRCRAHDPSW
QNWPLLEVAILGNIVADFPLINKSFNLSYSGHDG