Protein Info for LRK54_RS17085 in Rhodanobacter denitrificans FW104-10B01

Annotation: GNAT family N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 163 PF13673: Acetyltransf_10" amino acids 41 to 148 (108 residues), 29.6 bits, see alignment E=1.3e-10 PF00583: Acetyltransf_1" amino acids 44 to 134 (91 residues), 40.1 bits, see alignment E=8.4e-14 PF13508: Acetyltransf_7" amino acids 59 to 135 (77 residues), 40 bits, see alignment E=8.6e-14 PF08445: FR47" amino acids 79 to 137 (59 residues), 23.8 bits, see alignment E=7.2e-09

Best Hits

KEGG orthology group: None (inferred from 41% identity to pzu:PHZ_c3133)

Predicted SEED Role

"Transcriptional regulator, MarR family / GCN5-related N-acetyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (163 amino acids)

>LRK54_RS17085 GNAT family N-acetyltransferase (Rhodanobacter denitrificans FW104-10B01)
MRDALAIREFSDELAVHFRDINAEWINAMFRLEATDRDVLENPRARIIDAGGVILFVEAS
GLGIVGACALQKTGAASYELTKMGVRESARGMKAGEFLLAAIIERANSLGADPLYLLTNT
RCAAAIHLYEKLGFRHDAEIMARYGARYERCDVAMRYHAEALR