Protein Info for LRK54_RS16760 in Rhodanobacter denitrificans FW104-10B01

Annotation: transglycosylase SLT domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01464: SLT
  • amino acids 49 to 142 (94 residues), 60.4 bits, E=1.2e-20
• PF01476: LysM
  • amino acids 286 to 327 (42 residues), 56.5 bits, 2.1e-19

Predicted SEED Role

"Membrane-bound lytic murein transglycosylase D precursor (EC 3.2.1.-)" (EC 3.2.1.-)

KEGG Metabolic Maps

• Ascorbate and aldarate metabolism
• Glycosaminoglycan degradation
• Nucleotide sugars metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Protein Sequence (331 amino acids)

>LRK54_RS16760 transglycosylase SLT domain-containing protein (Rhodanobacter denitrificans FW104-10B01)
MPGCDADPAVLAWARHYTRHPRQFESQLQAVMPRLVYVQQVADRYDVAGEFVLLPWVESH
FQPVPARKRRPAGMWQIMPVTAGAMGLRVDGHYDGRLDVPAAANAVMKLLEQYHEQFHDW
RVADYAYNAGEFTIRKMVQAHGMPAAQPAIPQWPVRKVTREHLAKLLGMACVVREPERFN
VSLPTLPDEQQLVQTGISHSMPIARAADHAGMSVEALKHLNPAFRNNTIDTSAAPYLILP
ARHARQFRDALLEQADSSGGDLLASASRGDTAPSPMPAASPPWKVHTVRRGDSLWQIARK
YSVGVSQLRHWNHLNGHALKPGQTLTVGAPD