Protein Info for LRK54_RS16610 in Rhodanobacter denitrificans FW104-10B01

Annotation: 3-deoxy-8-phosphooctulonate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 PF00793: DAHP_synth_1" amino acids 8 to 266 (259 residues), 237.7 bits, see alignment E=5.8e-75 TIGR01362: 3-deoxy-8-phosphooctulonate synthase" amino acids 13 to 268 (256 residues), 422.2 bits, see alignment E=3e-131

Best Hits

Swiss-Prot: 85% identical to KDSA_STRM5: 2-dehydro-3-deoxyphosphooctonate aldolase (kdsA) from Stenotrophomonas maltophilia (strain R551-3)

KEGG orthology group: K01627, 2-dehydro-3-deoxyphosphooctonate aldolase (KDO 8-P synthase) [EC: 2.5.1.55] (inferred from 85% identity to sml:Smlt1712)

MetaCyc: 51% identical to 3-deoxy-8-phosphooctulonate synthase subunit (Arabidopsis thaliana col)
3-deoxy-8-phosphooctulonate synthase. [EC: 2.5.1.55]

Predicted SEED Role

"2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase (EC 2.5.1.55)" in subsystem KDO2-Lipid A biosynthesis (EC 2.5.1.55)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.55

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (278 amino acids)

>LRK54_RS16610 3-deoxy-8-phosphooctulonate synthase (Rhodanobacter denitrificans FW104-10B01)
MKLCGFDVGLDRPLFLIAGPCVVESEQLQLDTAGTLREITGRLGIHFIFKSSFDKANRSS
GESFRGPGLEEGLRILGEVRRQIGVPVLTDVHEYTPMDEVAAVVDVLQTPAFLCRQTDFI
QKVARAGKPVNIKKGQFLAPWDMKHVVAKAKAVGNDAIMVCERGASFGYNNLVSDMRSLS
VMRDTNCPVVFDATHSVQLPGGQGATSGGQREFVPVLARAAVAVGVAGLFAETHPDPSKA
LSDGPNAWPLGKMEALLETLLELDAVTKRHRFLEQDVS