Protein Info for LRK54_RS16210 in Rhodanobacter denitrificans FW104-10B01

Annotation: MotA/TolQ/ExbB proton channel family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 216 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 102 to 126 (25 residues), see Phobius details amino acids 145 to 166 (22 residues), see Phobius details PF01618: MotA_ExbB" amino acids 69 to 182 (114 residues), 99.6 bits, see alignment E=5.8e-33

Best Hits

KEGG orthology group: K03561, biopolymer transport protein ExbB (inferred from 62% identity to psu:Psesu_1316)

Predicted SEED Role

"Ferric siderophore transport system, biopolymer transport protein ExbB" in subsystem Campylobacter Iron Metabolism or Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (216 amino acids)

>LRK54_RS16210 MotA/TolQ/ExbB proton channel family protein (Rhodanobacter denitrificans FW104-10B01)
MAGGWAMVPILICSAIALAIVLERCWTLRRRSVLPPGLGEEVRQWARSGQLDPGHLEALA
NGSPLGELLASALVVRRQPRELIKERIEDTGRHVVHRMERYLNTLGTIALIGPLLGLFGT
VIGLIRMFMEVMAGGIGDPARMAGGIGEALICTASGLTVAIPAYVLHRYFRSRIAGYRVE
MEKQATALLDDLTLTPAAGVPVRPRRAPAPTAPSAG