Protein Info for LRK54_RS16090 in Rhodanobacter denitrificans FW104-10B01

Annotation: cytochrome c biogenesis heme-transporting ATPase CcmA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 211 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details TIGR01189: heme ABC exporter, ATP-binding protein CcmA" amino acids 11 to 199 (189 residues), 202.2 bits, see alignment E=3.3e-64 PF00005: ABC_tran" amino acids 28 to 164 (137 residues), 95.3 bits, see alignment E=5.1e-31

Best Hits

Swiss-Prot: 58% identical to CCMA_XANCP: Cytochrome c biogenesis ATP-binding export protein CcmA (ccmA) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K02193, heme exporter protein A [EC: 3.6.3.41] (inferred from 58% identity to xcc:XCC2219)

Predicted SEED Role

"ABC transporter involved in cytochrome c biogenesis, ATPase component CcmA" in subsystem Biogenesis of c-type cytochromes

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.41

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (211 amino acids)

>LRK54_RS16090 cytochrome c biogenesis heme-transporting ATPase CcmA (Rhodanobacter denitrificans FW104-10B01)
MTAASTAVPLLEARALSFHRQDEPVFAPLDFQLRAGELALVEGDNGSGKTTLLRMLAGLL
HTSAGELRWRGEPLQRERCAGEILFLGHQLGLKADLSPRENLRIAVGLHGAREGASVTTV
LARIGLRGYEDEPVRRLSAGQKKRAALARLLLLPASLWLLDEPYANLDRIGIALVNDLLE
SHTDAGGAAMVTSHGTVSFHGGEPRRIRMHD