Protein Info for LRK54_RS16055 in Rhodanobacter denitrificans FW104-10B01

Annotation: cytochrome c-type biogenesis protein CcmH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 146 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details transmembrane" amino acids 100 to 121 (22 residues), see Phobius details PF03918: CcmH" amino acids 5 to 132 (128 residues), 165 bits, see alignment E=3.3e-53

Best Hits

Swiss-Prot: 55% identical to CCMH_PSEAE: Cytochrome c-type biogenesis protein CcmH (ccmH) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02200, cytochrome c-type biogenesis protein CcmH (inferred from 61% identity to xac:XAC1674)

Predicted SEED Role

"Cytochrome c heme lyase subunit CcmL" in subsystem Biogenesis of c-type cytochromes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (146 amino acids)

>LRK54_RS16055 cytochrome c-type biogenesis protein CcmH (Rhodanobacter denitrificans FW104-10B01)
MIFVVLLAFIGVAHAQAIEPMPFRDHAQELRFQHLTHQLRCPMCQNETLADSNAPIARDL
RNQIFRMMQQGKSDEQIKQYLVARYSDFVLYDPPLSARTWLLWFGPLLILLGGAGVVLVA
IRRRNRAGSSTEAPADKGPIDNGDDW