Protein Info for LRK54_RS15920 in Rhodanobacter denitrificans FW104-10B01

Annotation: oligopeptide transporter, OPT family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 667 transmembrane" amino acids 20 to 37 (18 residues), see Phobius details amino acids 43 to 62 (20 residues), see Phobius details amino acids 74 to 98 (25 residues), see Phobius details amino acids 104 to 123 (20 residues), see Phobius details amino acids 167 to 190 (24 residues), see Phobius details amino acids 212 to 239 (28 residues), see Phobius details amino acids 269 to 289 (21 residues), see Phobius details amino acids 320 to 341 (22 residues), see Phobius details amino acids 353 to 380 (28 residues), see Phobius details amino acids 389 to 409 (21 residues), see Phobius details amino acids 421 to 440 (20 residues), see Phobius details amino acids 460 to 480 (21 residues), see Phobius details amino acids 498 to 514 (17 residues), see Phobius details amino acids 521 to 541 (21 residues), see Phobius details amino acids 553 to 579 (27 residues), see Phobius details amino acids 597 to 621 (25 residues), see Phobius details amino acids 633 to 656 (24 residues), see Phobius details TIGR00733: oligopeptide transporter, OPT family" amino acids 14 to 619 (606 residues), 682.3 bits, see alignment E=5.7e-209 PF03169: OPT" amino acids 14 to 617 (604 residues), 347.6 bits, see alignment E=8.5e-108 TIGR00728: oligopeptide transporter, OPT superfamily" amino acids 14 to 618 (605 residues), 364.2 bits, see alignment E=1.6e-112

Best Hits

KEGG orthology group: None (inferred from 55% identity to aex:Astex_3177)

Predicted SEED Role

"oligopeptide transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (667 amino acids)

>LRK54_RS15920 oligopeptide transporter, OPT family (Rhodanobacter denitrificans FW104-10B01)
MSAKPLSSVTPRTELTARGLIIGVVITLVFTAANVFFGLKAGLTFATSIPAAVISMAILR
GFKDSTMQENNIVQTVASSAGTLSAIIFVLPGLVMIGWWTGFPFWVTFGICATGGILGVM
YTIPLRRALVTDSDLPYPEGVACAEVLKVGGGDDAVAASAESGKSGLFAVAAGTIVSAVF
AVVVATKVFAGSVAQYFHVGDRGGASGYDFSLSFALLAVGHLVGLWVGLAMLLGALIAWG
WAVPHYTMLAAATGAAADMAQAAWGTKVRFIGAGTIGVAAIWTLAKLVKPVISGLSSAMA
SSRARKAGQGSTLPRTEHDMPIGIVGLISLLCLLPIGWLLGDFSIATGLGSHLWLLVGGG
LVFVVIMGFLVSAVCGYMAGLIGSSNSPLSGVGILVVIIAALLLLVAGVKSELSGDAGKG
LVAFALFATSVVFAVATIANNNLQDLKTGQLVDATPWKQQVALVVGVLVGAAVIPPVLDL
LNEAYGFAGMPGVDPARALAAPQAGLISALAQGVIQGNIDWSLIILGGAIGVALIVLDAV
LGRTTRSAALPPLAVGLGIYLPTSTTLMIVVGAVVGWYFDKRAERGPKPESTRQLGVLLA
SGMIVGESIIGVIIAAIVVFSGKGAPLALVGDGFGTAAIWIGGIAFVAVNVALYRWVAGL
GRTSATA