Protein Info for LRK54_RS15535 in Rhodanobacter denitrificans FW104-10B01

Annotation: DNA-directed RNA polymerase sigma-70 factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04542: Sigma70_r2
  • amino acids 17 to 80 (64 residues), 33 bits, E=4.4e-12
• PF20239: DUF6596
  • amino acids 185 to 285 (101 residues), 107.8 bits, E=3.2e-35

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 66% identity to bpy:Bphyt_6290)

Predicted SEED Role

"FIG00793649: hypothetical protein"

Protein Sequence (416 amino acids)

>LRK54_RS15535 DNA-directed RNA polymerase sigma-70 factor (Rhodanobacter denitrificans FW104-10B01)
MDRTAQARRAADAVARRSYGKLVAFLAAAMHDVAAAEDALSEAFATALADWPRTGCPANP
EAWLLTVARRKGIDRFRQHRNGEVAAVQLRILAEIEESAVTEGDDAAIPDRRLALLFACA
HPAIDTGIRAPLMLQVVLGLDAKAIAAAFLASPEAMGKRLGRAKQKIRQAGIPFVVPTRD
ELAGRLDGVLEAVYAAFAEGWSDPGGTDAIRRDLTAEALFLARLVVELLPQEPEALGLLA
CMLHAEARRAARRTAAGDYVPLAEQDVARWDAAMIDEAEALLLRASRLGRIGRYQLEAAL
QSAHVERCRSGRTDWAPEVQLYDALLALCDSPVVALNRALAIAELKGSEAALEIMDALAA
DGRLVDYQPYWAARAALLARTHAYRDARHAFDVAIGLAGDPAVRRFLQDRQAALPR