Protein Info for LRK54_RS15135 in Rhodanobacter denitrificans FW104-10B01

Annotation: bifunctional ADP-dependent NAD(P)H-hydrate dehydratase/NAD(P)H-hydrate epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 497 TIGR00197: YjeF family N-terminal domain" amino acids 15 to 212 (198 residues), 133.2 bits, see alignment E=9.9e-43 PF03853: YjeF_N" amino acids 33 to 191 (159 residues), 135.3 bits, see alignment E=2.1e-43 TIGR00196: YjeF family C-terminal domain" amino acids 229 to 483 (255 residues), 224.6 bits, see alignment E=1.6e-70 PF01256: Carb_kinase" amino acids 246 to 480 (235 residues), 216.3 bits, see alignment E=4.6e-68

Best Hits

KEGG orthology group: None (inferred from 52% identity to aeh:Mlg_0568)

Predicted SEED Role

"NAD(P)HX epimerase / NAD(P)HX dehydratase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (497 amino acids)

>LRK54_RS15135 bifunctional ADP-dependent NAD(P)H-hydrate dehydratase/NAD(P)H-hydrate epimerase (Rhodanobacter denitrificans FW104-10B01)
MPAHPYSRHLHTVEQLRAMERAALSALGISGPELMRRAASAALNSLRRHWPQLQQLCIHC
GPGNNGGDGFLLGVLAREAGLQVELVALTAASPGDAAAARAAWEAGGGRVRLWDAQSELP
DAELHVDALYGIGLHRAPEPAAAQLIEAINDSACPVLALDVPSGLDADTGSCPGAAIRAQ
VTVTFVAGKRGLHTGRAVDQVGVLELATLGVPDSVHADMLPDARLLVAEALPPRARYANK
GSYGHVLVIGGEYGMAGAVRLAGESALRAGAGLVSVATRADHVFALNAARPELMAHGVDG
PQALAPLLERASVLALGPGLGQAAWGHALWLTALDAGKPLVLDADGLNLLAREPRRFGAP
TVLTPHPGEAARLLEVSTAAVERDRFAAVRELARRYAAVVVLKGAGSLIADPDGRLDVCP
WGNPGMASGGMGDLLTGIVAALLAQGCGAWQAACLGVGLHARAGDRAAQQGERGLLAGDL
LAPLRALGNGMTGYEHD