Protein Info for LRK54_RS14820 in Rhodanobacter denitrificans FW104-10B01

Annotation: tRNA glutamyl-Q(34) synthetase GluQRS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 288 transmembrane" amino acids 14 to 31 (18 residues), see Phobius details amino acids 55 to 68 (14 residues), see Phobius details TIGR03838: glutamyl-queuosine tRNA(Asp) synthetase" amino acids 3 to 261 (259 residues), 339.3 bits, see alignment E=8.2e-106 PF00749: tRNA-synt_1c" amino acids 4 to 229 (226 residues), 122.8 bits, see alignment E=7.5e-40

Best Hits

Swiss-Prot: 58% identical to GLUQ_XANOR: Glutamyl-Q tRNA(Asp) synthetase (gluQ) from Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)

KEGG orthology group: K01894, glutamyl-Q tRNA(Asp) synthetase [EC: 6.1.1.-] (inferred from 61% identity to smt:Smal_2749)

Predicted SEED Role

"glutamyl-Q-tRNA synthetase" in subsystem Queuosine-Archaeosine Biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 6.1.1.-

Use Curated BLAST to search for 6.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (288 amino acids)

>LRK54_RS14820 tRNA glutamyl-Q(34) synthetase GluQRS (Rhodanobacter denitrificans FW104-10B01)
MSYRGRFAPSPTGHLHFGSLVAAVGSWLCARHAGGEWLLRMEDIDPPREVPGSAASILAA
LPAFGLGADAPALFQSQRIAAYDAAFERLRAADQVFPCWCSRSELADAGGIHRDGRCVAS
PQAAQAPAWRLRVPDIAIAFDDALQGPQRQNLRDEVGDFVIRRVEGLYSYQLACVVDDAY
QRITEVVRGLDLLDSTARQIWLQRCLGLPTPAYRHLPLVLDGEGRKLSKSGQAFPIDPAA
PLPALRQALAFLRVPALPAAADAHQLLVQALANFDPADLPHCSGHSVA