Protein Info for LRK54_RS14095 in Rhodanobacter denitrificans FW104-10B01

Annotation: cyclic nucleotide-binding domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00027: cNMP_binding
  • amino acids 48 to 131 (84 residues), 57.5 bits, E=1.7e-19
• PF13545: HTH_Crp_2
  • amino acids 166 to 239 (74 residues), 54.3 bits, E=1.6e-18
• PF00325: Crp
  • amino acids 190 to 221 (32 residues), 48.8 bits, 6.9e-17

Best Hits

Swiss-Prot: 42% identical to BTR_BORPE: Transcriptional regulatory protein btr (btr) from Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)

KEGG orthology group: K01420, CRP/FNR family transcriptional regulator, anaerobic regulatory protein (inferred from 43% identity to alv:Alvin_0388)

Predicted SEED Role

"transcriptional regulator, Crp/Fnr family" in subsystem Oxidative stress

Protein Sequence (253 amino acids)

>LRK54_RS14095 cyclic nucleotide-binding domain-containing protein (Rhodanobacter denitrificans FW104-10B01)
MVPETNVFDLNQLRRSCSSCALGELCLPAGIGHDDLDRLDTTVRDKRMLDRGGVLYRDGD
PFAALYVVRSGSLKTFVQDEAGDVQVLGFHLPGEIIGFDALALNRHVSQAEALERSSICE
LPYARLQQVISEVPALHRQLMRVISREVIEEHRHLVMMGRQQAQEQLAIFLKSLADRYQR
LQRDGIALSLPMSRYDIANYLGLVVETVSRLFSRLEEMGVLEVNRKAVRILRPDLLADLC
RNNTAATKRHDTG