Protein Info for LRK54_RS14040 in Rhodanobacter denitrificans FW104-10B01

Annotation: molybdate ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF13531: SBP_bac_11" amino acids 35 to 257 (223 residues), 189.4 bits, see alignment E=8.6e-60 TIGR01256: molybdate ABC transporter, periplasmic molybdate-binding protein" amino acids 39 to 256 (218 residues), 187.2 bits, see alignment E=2e-59 PF01547: SBP_bac_1" amino acids 46 to 246 (201 residues), 31.2 bits, see alignment E=2.4e-11

Best Hits

Swiss-Prot: 45% identical to MODA_AZOVI: Molybdate-binding protein ModA (modA) from Azotobacter vinelandii

KEGG orthology group: K02020, molybdate transport system substrate-binding protein (inferred from 54% identity to psa:PST_1347)

Predicted SEED Role

"Molybdenum ABC transporter, periplasmic molybdenum-binding protein ModA (TC 3.A.1.8.1)" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum (TC 3.A.1.8.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (258 amino acids)

>LRK54_RS14040 molybdate ABC transporter substrate-binding protein (Rhodanobacter denitrificans FW104-10B01)
MLVRRAVPVLLAIASLAAWPAGRASASTPPVARARVAVAANFSEVAHLLAAQYTRRSGNR
IDISVASTGKLYAQIRHGAPFDVLLAADDSTPQRLVDEGLAVRSSLYDYARGRLVLWSRD
AALVADGEQVLRRHDFRKFAIANPALAPYGAAARQVLQHVGRWDTLQPRLVLGENVGQAT
QFVLSGNAEAGLLPRSLVLEAQRQVGGSAWLVPADWHRPIVQSAVLLDHGRDNPAAIGFL
EYLRDDTARRTIAAHGYD