Protein Info for LRK54_RS13745 in Rhodanobacter denitrificans FW104-10B01

Annotation: GNAT family N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 164 PF13527: Acetyltransf_9" amino acids 8 to 113 (106 residues), 31.4 bits, see alignment E=4.6e-11 PF00583: Acetyltransf_1" amino acids 40 to 137 (98 residues), 68.4 bits, see alignment E=1.7e-22 PF13302: Acetyltransf_3" amino acids 47 to 138 (92 residues), 25.6 bits, see alignment E=4.4e-09 PF13673: Acetyltransf_10" amino acids 49 to 141 (93 residues), 32.6 bits, see alignment E=1.9e-11 PF13508: Acetyltransf_7" amino acids 52 to 138 (87 residues), 51.8 bits, see alignment E=2.2e-17

Best Hits

KEGG orthology group: None (inferred from 53% identity to bgd:bgla_2g27590)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (164 amino acids)

>LRK54_RS13745 GNAT family N-acetyltransferase (Rhodanobacter denitrificans FW104-10B01)
MRAGLVLREIGADEFARVWPLFRTVLAGGDTYMYPPDLGMDQACAMWTTSPSRCFVCERD
GEVLGCYRLAPNQIGLGDHVANGSYMVAPEARGQGIASAMCEHSLEQARQTGFTAMQFNC
VVASNTIAVRLWQRHGFRIVGTVPGGFRHARLGPTDLYVMHRTL