Protein Info for LRK54_RS13640 in Rhodanobacter denitrificans FW104-10B01

Annotation: chemotaxis protein CheA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 663 PF01627: Hpt" amino acids 10 to 104 (95 residues), 57.5 bits, see alignment E=2.7e-19 PF02895: H-kinase_dim" amino acids 274 to 336 (63 residues), 69.9 bits, see alignment E=4.2e-23 PF02518: HATPase_c" amino acids 386 to 521 (136 residues), 62.4 bits, see alignment E=1e-20 PF01584: CheW" amino acids 527 to 654 (128 residues), 86.4 bits, see alignment E=2.8e-28

Best Hits

Predicted SEED Role

"Signal transduction histidine kinase CheA (EC 2.7.3.-)" in subsystem Bacterial Chemotaxis or Flagellar motility or Two-component regulatory systems in Campylobacter (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (663 amino acids)

>LRK54_RS13640 chemotaxis protein CheA (Rhodanobacter denitrificans FW104-10B01)
MGAVDLTQFHKTFFEESLEGLDAMETALLALDSGSTDHELVHTIFRAAHSIKGGAATFGF
ADVAAFTHVVESLLEEVRSERRAVDAELIDLLLRSVDCLRAMLARSAGGQPVADADSEAL
RGELVRRVSGELATAPAAAAPKAASANGWDIRFVALPHLLQTGNDPLRLFRELGQLGRLE
VRRAFVLDSAPARLAELDPGHCHLGWELRLHGAVARGDVDAVFDWLDGDCELAIAALAAE
SPAAAALAAVAAPAAAPAPAAPPAREATTAGEGSSIRVGIDKVDALIDMMGELVITQSML
SDIGENFQPSQLERLREGLLQLERNTRELQESVMRIRMLPIGSVFNRFPRLVRDLERKLG
KQVRLELHGEHTELDKTVLEKIGDPLVHLVRNAIDHGLELPAQRKAAGKPETGTLKLNAY
HEGGNIVVQISDDGAGLNRAAIVAKAQQRGLLGAGQEPSDIEVAELIFQPGFSTAAQATD
LSGRGVGMDVVRRNVRDLGGSVGVKSEAGKGSVFTIALPLTLAIIDGLVTAVGHERYIVP
LTSIVESQRLGAEAVRRIAGGGEVFQFRGEYLPLMRLHRAFDCADAITEVERGIVVVIED
DSRRVGLLVDDLLGQQQAVIKSLEKHYQRVQGVSGATILSDGSVALIVDVGGVVRLGRRS
KAA