Protein Info for LRK54_RS13415 in Rhodanobacter denitrificans FW104-10B01

Annotation: flagellar hook capping protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 212 PF03963: FlgD" amino acids 5 to 70 (66 residues), 73.7 bits, see alignment E=1.7e-24 PF13861: FLgD_tudor" amino acids 79 to 208 (130 residues), 48.6 bits, see alignment E=1.2e-16 PF13860: FlgD_ig" amino acids 103 to 171 (69 residues), 60 bits, see alignment E=2.7e-20

Best Hits

KEGG orthology group: K02389, flagellar basal-body rod modification protein FlgD (inferred from 38% identity to xal:XALc_1426)

Predicted SEED Role

"Flagellar basal-body rod modification protein FlgD" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (212 amino acids)

>LRK54_RS13415 flagellar hook capping protein (Rhodanobacter denitrificans FW104-10B01)
MNVSNVGASAGQAASAGKDKTLSQADFLSLLTQQMRNQDPTKPMDSSQMVSQLAQISQVS
ATQALQSSFDGLSAALQGNQILQASGMVGRNVVVPSAAGTLRDGGLDGAVNVPDGGGQVL
VKISDTHGNVLRTISLGTPAAGLVRFHWDGTGDNGQALPAGAYGLAAQAGNTAVATYASG
KVTGVGMTGSDGVYLDVDGFGGALLSQVAQIN