Protein Info for LRK54_RS13190 in Rhodanobacter denitrificans FW104-10B01

Annotation: glycosyltransferase, exosortase A system-associated

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 432 TIGR04063: PEP-CTERM/exosortase A-associated glycosyltransferase, Daro_2409 family" amino acids 23 to 421 (399 residues), 613 bits, see alignment E=1.2e-188 PF13579: Glyco_trans_4_4" amino acids 36 to 212 (177 residues), 88.1 bits, see alignment E=2e-28 PF13439: Glyco_transf_4" amino acids 44 to 216 (173 residues), 77.3 bits, see alignment E=3.8e-25 PF00534: Glycos_transf_1" amino acids 228 to 391 (164 residues), 108.5 bits, see alignment E=7.1e-35 PF13692: Glyco_trans_1_4" amino acids 240 to 384 (145 residues), 109.1 bits, see alignment E=5.5e-35 PF13524: Glyco_trans_1_2" amino acids 334 to 412 (79 residues), 35.6 bits, see alignment E=2.3e-12

Best Hits

KEGG orthology group: None (inferred from 64% identity to hse:Hsero_2750)

Predicted SEED Role

"Glycosyl transferase, group 1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (432 amino acids)

>LRK54_RS13190 glycosyltransferase, exosortase A system-associated (Rhodanobacter denitrificans FW104-10B01)
MNDVLSVAPRQARPEASTERPLRILHVLDHSLPLHSGYTFRTLAILEAQRALGWETMHLT
GPKQGSDRQREEHVGDWMFYRTPPASGLLARLPLVRHRCLMRALQTRLAEVVDNVHPDIL
HAHSPVLNAIPALAVGRAAGIPVVYEVRAFWEDAAVDLGTAREGGARYRLTRALETRALQ
RADAVTTICEGLRGDMLKRGIPADKITVIPNAVDTTQFRSTASAEDAELREKYGLTRGTT
LGFAGSFYAYEGLDGLLRAMPLVLRAVPQARLLLLGGGPQDAELQALAARLGLDHVVHFV
GRVPHSEVARYYNAMDVMVYPRISRRLTELVTPLKPLEAMAMGKLVAASDVGGHRELIRD
GHNGHLFSAGSAEALAQCLIKLLETPASWGRVIAHGREFVERERTWSASVARYRAVYTDV
LDRHRRERGRGP