Protein Info for LRK54_RS13005 in Rhodanobacter denitrificans FW104-10B01

Annotation: sugar porter family MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 474 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 56 to 77 (22 residues), see Phobius details amino acids 89 to 108 (20 residues), see Phobius details amino acids 113 to 134 (22 residues), see Phobius details amino acids 153 to 175 (23 residues), see Phobius details amino acids 186 to 207 (22 residues), see Phobius details amino acids 267 to 293 (27 residues), see Phobius details amino acids 309 to 330 (22 residues), see Phobius details amino acids 337 to 358 (22 residues), see Phobius details amino acids 375 to 400 (26 residues), see Phobius details amino acids 412 to 434 (23 residues), see Phobius details amino acids 441 to 461 (21 residues), see Phobius details TIGR00879: MFS transporter, sugar porter (SP) family" amino acids 16 to 471 (456 residues), 362.2 bits, see alignment E=2e-112 PF00083: Sugar_tr" amino acids 24 to 472 (449 residues), 353.2 bits, see alignment E=2.3e-109 PF07690: MFS_1" amino acids 27 to 425 (399 residues), 109.3 bits, see alignment E=2e-35

Best Hits

KEGG orthology group: None (inferred from 65% identity to kra:Krad_3493)

Predicted SEED Role

"Glucose/mannose:H+ symporter GlcP" in subsystem Trehalose Uptake and Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (474 amino acids)

>LRK54_RS13005 sugar porter family MFS transporter (Rhodanobacter denitrificans FW104-10B01)
MSTMDMTGDGLGQRATARVVLISAAAALGGFLFGFDTAVINGAVDAVRGGFALDAAQIGF
AVSCALLGSALGAWYAGMLANRFGRVRTMQVAAVLLVASALGSGLVTAVWDLILWRLVGG
IGVGVASVIAPTYIAEVSPAHIRGRLGSMQQLAIVLGIFAALLSDAWLAGVAGGAAQPLW
FGLAAWRWMFLVATLPALVYGTLVLGVPESPRHLVAKGRLDEARVVLRKVLNMHSETALD
NKLRDIEDSLRSEHRPRLRDLCGKTAGLLPVVWIGILLSVFQQFVGINVIFYYSSTLWHS
VGFSEADSFTITVVTSIVNVLVTLVAIALVDKIGRKPLLVVGSAGMAITLGLMAWCFSQA
TGSGATLSLPGATGMVALVAANAYVVFFGVSWGPVVWVLLGEMFPNRIRATALAVAAAAQ
WLANFAITSTFPALAELGLSFAYGLYAGFALLSLLFVLAGVRETKGIELEDMRA