Protein Info for LRK54_RS12245 in Rhodanobacter denitrificans FW104-10B01

Annotation: UDP-N-acetylmuramate--L-alanine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01082: UDP-N-acetylmuramate--L-alanine ligase
  • amino acids 19 to 466 (448 residues), 559.5 bits, E=3.3e-172
• PF01225: Mur_ligase
  • amino acids 19 to 116 (98 residues), 110.1 bits, E=8.4e-36
• PF08245: Mur_ligase_M
  • amino acids 121 to 302 (182 residues), 110 bits, E=2.3e-35
• PF02875: Mur_ligase_C
  • amino acids 329 to 412 (84 residues), 52.3 bits, E=9e-18

Best Hits

Swiss-Prot: 66% identical to MURC_XANCP: UDP-N-acetylmuramate--L-alanine ligase (murC) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K01924, UDP-N-acetylmuramate--alanine ligase [EC: 6.3.2.8] (inferred from 67% identity to psu:Psesu_0640)

MetaCyc: 57% identical to UDP-N-acetylmuramate--L-alanine ligase (Escherichia coli K-12 substr. MG1655)
UDP-N-acetylmuramate--L-alanine ligase. [EC: 6.3.2.8]

Predicted SEED Role

"UDP-N-acetylmuramate--alanine ligase (EC 6.3.2.8)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.8)

MetaCyc Pathways

• peptidoglycan biosynthesis I (meso-diaminopimelate containing) (10/12 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis I (meso-diaminopimelate containing) (7/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis II (lysine-containing) (6/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis III (meso-diaminopimelate containing) (6/8 steps found)
• peptidoglycan biosynthesis III (mycobacteria) (10/15 steps found)
• peptidoglycan biosynthesis II (staphylococci) (11/17 steps found)
• peptidoglycan biosynthesis IV (Enterococcus faecium) (11/17 steps found)
• peptidoglycan biosynthesis V (β-lactam resistance) (10/17 steps found)

KEGG Metabolic Maps

• D-Glutamine and D-glutamate metabolism
• Peptidoglycan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.8

Protein Sequence (479 amino acids)

>LRK54_RS12245 UDP-N-acetylmuramate--L-alanine ligase (Rhodanobacter denitrificans FW104-10B01)
MTPRRLHAHEDPMSTFRRVHFIGIGGVGMSGIAEVLHNLGYAVSGSDRANSPTAQRLQQL
GIVVHVGHAVENIGDADVVVTSSAIRQDNPELVAAREARIPVIPRAEMLGELMRFRRGVA
IAGTHGKTTTTSLTASVLAEAGYDPTFVIGGQLNAAGANARLGSGQYLVAEADESDGSFL
LLSPVIAAVTNIDADHLENYHGDFAEVKKAFADFLHRLPFYGLAVLCVDDPEVAVLAKST
TRRVMTYGIDAADADVRARNVSQHGFEMHFELLLPGRDAALPVKLNLPGRHNVLNALAAS
AIGWQLGVEAEALARALENFQGVGRRFHRRGEIALDQGSVLLVDDYGHHPRELAAVFAAA
RGGWPGRRLVVGFQPHRYSRTRDLLDDFANVLAEVDVLVLTDVYPAGEAPIAGADGRALA
RAVRARGKVDPVLVEHPRELKETLPALLRDGDLLLLLGAGDIGTAAVEMAQLGNLRTHK