Protein Info for LRK54_RS12200 in Rhodanobacter denitrificans FW104-10B01

Annotation: division/cell wall cluster transcriptional repressor MraZ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 148 PF02381: MraZ" amino acids 1 to 75 (75 residues), 40.7 bits, see alignment E=9.6e-15 amino acids 80 to 132 (53 residues), 35.4 bits, see alignment E=4.4e-13 TIGR00242: division/cell wall cluster transcriptional repressor MraZ" amino acids 1 to 146 (146 residues), 102.2 bits, see alignment E=1.2e-33

Best Hits

Swiss-Prot: 59% identical to MRAZ_XANCB: Transcriptional regulator MraZ (mraZ) from Xanthomonas campestris pv. campestris (strain B100)

KEGG orthology group: K03925, MraZ protein (inferred from 65% identity to psu:Psesu_0631)

Predicted SEED Role

"Cell division protein MraZ" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (148 amino acids)

>LRK54_RS12200 division/cell wall cluster transcriptional repressor MraZ (Rhodanobacter denitrificans FW104-10B01)
MFQGETAITIDDKGRLTIPTAYREQVAGECANRLVLTYNPFESGCLWLFPYAAWELVRDQ
VNALSKVVKAHRDMQMKLVGAAAVVEPDSASRVLLPASQRATTGIEKKAVLLGMGDKFEL
WSEQEHLKKIRQTIGEGEITQAMAELRL