Protein Info for LRK54_RS11855 in Rhodanobacter denitrificans FW104-10B01

Annotation: type IV pilus secretin PilQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 714 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF11741: AMIN" amino acids 54 to 126 (73 residues), 28.4 bits, see alignment E=2.9e-10 amino acids 159 to 261 (103 residues), 65.4 bits, see alignment E=8.9e-22 TIGR02515: type IV pilus secretin PilQ" amino acids 280 to 709 (430 residues), 505.1 bits, see alignment E=9e-156 PF07660: STN" amino acids 306 to 353 (48 residues), 35.3 bits, see alignment 1.6e-12 PF03958: Secretin_N" amino acids 380 to 456 (77 residues), 57.5 bits, see alignment E=2.5e-19 PF00263: Secretin" amino acids 543 to 709 (167 residues), 173.2 bits, see alignment E=7.3e-55

Best Hits

Predicted SEED Role

"Type IV pilus biogenesis protein PilQ" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (714 amino acids)

>LRK54_RS11855 type IV pilus secretin PilQ (Rhodanobacter denitrificans FW104-10B01)
MRHASRYILMGLLIAGATWASAAMAATTTLKNISYDALPGGSVELHMDFGDGPVPQPKIF
TTGNPPRIAVDFADTDNAAPRHLDIGKGSTSGVSAVAAGGRTRVVVELMRESSYRSRVEG
NSLVLTVNNGSTDQSVTTASTIDPTKALPSSAAGPAISNIDFRRGPNGEGRVLIDFSGSG
ANAEMTRKGDKVLVTIDHANLPANLAQRLDTLDFATPVQSIVTRAGMGGGARMEIAVKGN
VETSAYQTADQYVVEVAPKKADASKDAKLARLGQEPSYNGKRVTFNFQDIPVRSALQLIA
DISGLNLVASDSVGGSVTLRLVNVPWDQALDVILRAKSLDKRRNGNVVWVAPQAELAKYE
QDLADAKLKAQDTAELITDYVPISYGKASDIAKLLTSGSMQGGGGSSGGNTQRGFLSPRG
SVSFDERTNTLLLNDTPEKIRQLRELIAVLDKPVQQVLIESRIVVASDDFTRELGAKFGV
NGRINNTEFQNAAAATPALTAGLGGGNVTSGGLNVNLPVTPAAGSFGLAILGANYAIDLE
LSAAQTEGRGEVISSPRVITANQQEAVIRQGQEIGYVTFQNSAGSGAGSGTATVQFKDAV
LELKVTPTITADNRVYLMINVKKDALAGYVDAPGSGKIPTIDTREINTSVLVDNGQTVVL
GGIYEINKANTMTKVPGLGDIPGVGVLFRKTSRTNTKAELLIFVTPRILSDTLQ