Protein Info for LRK54_RS11590 in Rhodanobacter denitrificans FW104-10B01

Annotation: adenosylmethionine decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 TIGR03331: S-adenosylmethionine decarboxylase proenzyme" amino acids 7 to 260 (254 residues), 453.1 bits, see alignment E=1.3e-140 PF02675: AdoMet_dc" amino acids 48 to 167 (120 residues), 53.9 bits, see alignment E=1e-18

Best Hits

Swiss-Prot: 84% identical to SPED_XANAC: S-adenosylmethionine decarboxylase proenzyme (speD) from Xanthomonas axonopodis pv. citri (strain 306)

KEGG orthology group: K01611, S-adenosylmethionine decarboxylase [EC: 4.1.1.50] (inferred from 86% identity to psu:Psesu_0328)

MetaCyc: 62% identical to S-adenosylmethionine decarboxylase proenzyme (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"S-adenosylmethionine decarboxylase proenzyme (EC 4.1.1.50), prokaryotic class 1A" in subsystem Polyamine Metabolism (EC 4.1.1.50)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.50

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (261 amino acids)

>LRK54_RS11590 adenosylmethionine decarboxylase (Rhodanobacter denitrificans FW104-10B01)
MVKPLPRLRLQGFNNLTKALSFNIYDICYAVSEDQRQRYIEYIDEQYDADRLTQILTDVA
EIIGANILNVARQDYDPQGASVTILISEEPVVEKLGRDSIAGAVVAHMDKSHITVHTYPE
THPHNGIATFRADIDVATCGVISPLKALNYLIDSFESDIVVCDYRVRGFTRDVKGKKHFI
DHKINSVQDYLAKHIRQKYEMFDVNVYQENMFHTKMHIKDFDLDTYLFESHADDLSFKER
QRIESLLRREIEELFHGRNLM