Protein Info for LRK54_RS11425 in Rhodanobacter denitrificans FW104-10B01

Annotation: SIS domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01380: SIS
  • amino acids 59 to 191 (133 residues), 37.8 bits, E=8.2e-14

Best Hits

KEGG orthology group: K02082, tagatose-6-phosphate ketose/aldose isomerase [EC: 5.-.-.-] (inferred from 53% identity to cak:Caul_0318)

Predicted SEED Role

"Galactosamine-6-phosphate isomerase (EC 5.3.1.-)" in subsystem N-Acetyl-Galactosamine and Galactosamine Utilization (EC 5.3.1.-)

KEGG Metabolic Maps

• Biosynthesis of ansamycins
• Biosynthesis of steroids
• Carotenoid biosynthesis - General
• Galactose metabolism
• Inositol phosphate metabolism
• Lipopolysaccharide biosynthesis
• Pentose and glucuronate interconversions

Isozymes

Compare fitness of predicted isozymes for: 5.-.-.-, 5.3.1.-

Use Curated BLAST to search for 5.-.-.- or 5.3.1.-

Protein Sequence (386 amino acids)

>LRK54_RS11425 SIS domain-containing protein (Rhodanobacter denitrificans FW104-10B01)
MTPTEYLGLTEPDLIATGAIWTAREIEQQPQMLQRTHALVARLHAKIRAFAAPLIDNPAA
RVILTGAGSSSYIGQCVAPLLNRMLAARVDAVPTTDIVCAPSLYLDPEQPLLLVSFGRSG
NSPESLAAVELAESLVREVRHLLIVCNADGALGKVPAANAMTLLLPAETHDTGFAMTSSF
SCMMYAVVAALLPAGTMDGRIGAIAGATGRVIGESLPLLHELALGRYDRVVYLGSGVLQG
LAREASLKLGELTNGAVATCFDSPLGFRHGPKTFITGRTLVMVFVSNDELTRRYDLDLVD
ELRRDGCATRIVEVSARPRTASGADGITVPAMAGAVDLDLLWPCVAIAQIHAFLRARAMG
VAPDNPNPAGVVNRVVQGVRLYVTNA