Protein Info for LRK54_RS11325 in Rhodanobacter denitrificans FW104-10B01

Annotation: trimeric intracellular cation channel family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 208 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 33 to 51 (19 residues), see Phobius details amino acids 66 to 86 (21 residues), see Phobius details amino acids 95 to 115 (21 residues), see Phobius details amino acids 121 to 140 (20 residues), see Phobius details amino acids 152 to 170 (19 residues), see Phobius details amino acids 176 to 197 (22 residues), see Phobius details PF03458: Gly_transporter" amino acids 9 to 83 (75 residues), 80.6 bits, see alignment E=3.1e-27 amino acids 95 to 166 (72 residues), 72.3 bits, see alignment E=1.2e-24

Best Hits

KEGG orthology group: None (inferred from 60% identity to bge:BC1002_4781)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (208 amino acids)

>LRK54_RS11325 trimeric intracellular cation channel family protein (Rhodanobacter denitrificans FW104-10B01)
MNEQLLFNLVDLAGTFAFAISGATAARRCNLDLFGILAIAFITACGGGIVRDLCIGAVPP
AGLSDWRYLLTAVVAALLTVVAYRWVERLTYPVRLFDAMGLGLFAVYGAHKALLFGHNAE
VAILLGMVTAIGGGMARDVLLARVSIVLQQEIYALAALAGAALAVLGEYLHWPAVWATWL
PILFCFGLRFASLRYHWNLPRFGRERQA