Protein Info for LRK54_RS11120 in Rhodanobacter denitrificans FW104-10B01

Annotation: tetratricopeptide repeat-containing sulfotransferase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 609 PF13432: TPR_16" amino acids 6 to 65 (60 residues), 21.2 bits, see alignment 1.7e-07 amino acids 73 to 134 (62 residues), 29.2 bits, see alignment E=5.4e-10 amino acids 171 to 232 (62 residues), 15.7 bits, see alignment E=8.9e-06 amino acids 245 to 299 (55 residues), 23.4 bits, see alignment 3.7e-08 PF14559: TPR_19" amino acids 8 to 69 (62 residues), 30.8 bits, see alignment E=1.5e-10 PF13174: TPR_6" amino acids 39 to 64 (26 residues), 12.7 bits, see alignment (E = 8.6e-05) PF13469: Sulfotransfer_3" amino acids 350 to 537 (188 residues), 128.1 bits, see alignment E=3.1e-40 PF00685: Sulfotransfer_1" amino acids 350 to 537 (188 residues), 54.1 bits, see alignment E=7.7e-18

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (609 amino acids)

>LRK54_RS11120 tetratricopeptide repeat-containing sulfotransferase family protein (Rhodanobacter denitrificans FW104-10B01)
MINDILSALQGGRPADVERLSRAALSERPDDPDLALFLAIGLQQQGRLAEALEVYAALAQ
NHPDDSLHWGNYATALREAGRVQEAEQAYLRSIALAPDNGEQLINLGLLQLERKDYQAAR
DTLLRAHALDPAAPAVRIHAARACSACRDSRAEELLRPWRDWTALDDPLQLELADLQLVL
GEANIARVLLEELLARTPGHLPARLLLAAVYERVNDLDGSAALLDQLERDHPALDAEAQL
EIVHQRAKLALRRGQTEQARRLLQQAGPRTPDDYAHFFSLAEACDKLRDYPGAIAALHEA
HARQIEELKHNAPRRFDPGAPVLPAAVERIGAEEFRRWPVLQGPDSANSPVFIVGFPRSG
TTLLELMLDAHPALQSMDERPFFTILSDQLADHGIVVPQDLYKLDQHACDELRKGYVSLV
CSKVRRRWSAQLVDKNPLNMLWLPLIYRLFPEAKFILALRHPCDVLVSNYMQNFRAAVLA
VACASMEKLATAYVTAMECWLHDVALFQPNVFVSRYEDLVADPAAQTRRIADFLGLEDAA
PLLHFDRHARDKGFIATPSYAQVTQPVNRKGLDRWKRYREALAPALPILDPMLRHWGYSV
ADADEAGAG