Protein Info for LRK54_RS10885 in Rhodanobacter denitrificans FW104-10B01

Annotation: glucokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 transmembrane" amino acids 263 to 285 (23 residues), see Phobius details PF02685: Glucokinase" amino acids 10 to 326 (317 residues), 342.6 bits, see alignment E=1e-106 TIGR00749: glucokinase" amino acids 10 to 323 (314 residues), 268.8 bits, see alignment E=3.3e-84

Best Hits

Swiss-Prot: 50% identical to GLK_XANCB: Glucokinase (glk) from Xanthomonas campestris pv. campestris (strain B100)

KEGG orthology group: K00845, glucokinase [EC: 2.7.1.2] (inferred from 52% identity to xal:XALc_1831)

Predicted SEED Role

"Glucokinase (EC 2.7.1.2)" in subsystem Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis (EC 2.7.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.2

Use Curated BLAST to search for 2.7.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (338 amino acids)

>LRK54_RS10885 glucokinase (Rhodanobacter denitrificans FW104-10B01)
MSQPSHAPTLLVDLGGTNVRFGVADPSRDQPLLADSIRRYRVAEHDSLVATAQQYLADTG
LKVSRAIVAAAGRIVDGETVKVTNNPWAISAQQTAAALDLEYVHLVNDFAAQSMAVTLLQ
GDDLVDVGTVPRPVVGAEAEQTFAVVGPGTGLGVGGLLVRGGHCSVLQTEGGHAGFAAHT
PEDIAILDYLNHKYGRVSNERLICGQGLVNLYDAICHMVGAQPEALKPEDITARAKDGSC
SLCTRTVETFAGIFGSVAGDLVLTLGAWNGVYLTGGLIPILLPWLERGRFRERFEAKGRF
RDIMEKVPTQAIMNPEPGLLGAAALAVLESGRTLLPPR