Protein Info for LRK54_RS10580 in Rhodanobacter denitrificans FW104-10B01

Annotation: sodium:proton antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 598 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 30 to 48 (19 residues), see Phobius details amino acids 54 to 71 (18 residues), see Phobius details amino acids 92 to 112 (21 residues), see Phobius details amino acids 118 to 138 (21 residues), see Phobius details amino acids 151 to 171 (21 residues), see Phobius details amino acids 182 to 206 (25 residues), see Phobius details amino acids 216 to 235 (20 residues), see Phobius details amino acids 241 to 257 (17 residues), see Phobius details amino acids 269 to 287 (19 residues), see Phobius details amino acids 293 to 317 (25 residues), see Phobius details amino acids 329 to 349 (21 residues), see Phobius details amino acids 361 to 379 (19 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 13 to 387 (375 residues), 114.5 bits, see alignment E=2.7e-37

Best Hits

KEGG orthology group: None (inferred from 60% identity to net:Neut_0976)

Predicted SEED Role

"Sodium/hydrogen exchanger family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (598 amino acids)

>LRK54_RS10580 sodium:proton antiporter (Rhodanobacter denitrificans FW104-10B01)
MTIELGLMLAGMLMIGFLAQWLAWRVKLPAILFLLLAGIVLGPVSGVLDPDKLLGGLLFP
TVSLAVALILFEGSLTLRFHELPGIGKAVRGLVSYGAVASLLLLALAAHLVAGLAWPIAL
LFGALACVTGPTVIAPMLRTLRPNARIANTLRWEGIVIDPFGALFAVLVYEAIVSRQEGH
TIGIFVATIGCGVVIGALSAWLMAFFLRRQMIPEYLQNYAVLAAVLLAFSLSNTITHESG
LLAVTIMGIALGNLRGVHIDDILDFKESLTTVLVSLLFILLAARLHWPLPEGMLGAGIAL
FVIAQLVVRPLTVAIASFGSGLNWRERALIGWVAPRGIVAASVSALFALRLGALGVAGAE
ALVPLVFTLIIGTVILQSATARPLAIWLKVAEPEPRGVLIFGSDPVARAIGKALDEAGFR
VVLADDDWDGIRLARMEGLATFFGNPASPHAERYLDLTGIGRLLAVSTHRERNSLACVHY
RQEFGREKVYRLRNLTPQENTDRAALAGSLLAPPLFDEEMTHGRFAELLAQGWRVKSTRL
SATFDWPHFIEQYGSNTVLMFGVEEKGALRVASAKRELEPKPGWTVIALVPPAEPSAE