Protein Info for LRK54_RS10215 in Rhodanobacter denitrificans FW104-10B01

Annotation: sterol desaturase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 transmembrane" amino acids 7 to 20 (14 residues), see Phobius details amino acids 39 to 60 (22 residues), see Phobius details amino acids 81 to 101 (21 residues), see Phobius details amino acids 133 to 151 (19 residues), see Phobius details PF04116: FA_hydroxylase" amino acids 137 to 276 (140 residues), 98.2 bits, see alignment E=2.6e-32

Best Hits

KEGG orthology group: None (inferred from 63% identity to xal:XALc_0717)

Predicted SEED Role

"FIG00537023: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (372 amino acids)

>LRK54_RS10215 sterol desaturase family protein (Rhodanobacter denitrificans FW104-10B01)
MFDLPSWWAHLVSWLSGHAVVPLLDALHLDGLSGNPDDIAASLLIAALQLGIIGLIFRPL
ESWFPAERWSDRRLTRVDRNYTLLMLLGIFPLFTYLVLMPFSHLLGGGGEAVDPGTGSAL
ALTHWVPWFNRHPYVLFAVYYVIYDFTYYWMHRTQHAIPWWWALHSMHHSTRQMSCWTND
RGSLVDGFIQSMILATVGLAIGVDPDEFAWLMLLGELVQNFSHTNVRLGFGRVFDRVFVA
PKFHRLHHMLVDPERPTLHNCNYGQVLSVWDVLFGTALYGEPPRPTGVGDPIVDADNDYG
LVGLHWAALKRFWVAVRQPAGWRPGEVAFGADYTPIPVDQLDLHALARHASAVIADEDVP
TSGSAAVESVPG