Protein Info for LRK54_RS10155 in Rhodanobacter denitrificans FW104-10B01

Annotation: Sua5/YciO/YrdC/YwlC family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01300: Sua5_yciO_yrdC
  • amino acids 16 to 187 (172 residues), 148.1 bits, E=9.9e-48

Best Hits

Swiss-Prot: 52% identical to TSAC_STRMK: Threonylcarbamoyl-AMP synthase (tsaC) from Stenotrophomonas maltophilia (strain K279a)

KEGG orthology group: K07566, putative translation factor (inferred from 52% identity to smt:Smal_3592)

MetaCyc: 44% identical to L-threonylcarbamoyladenylate synthase (Escherichia coli K-12 substr. MG1655)
RXN-14569 [EC: 2.7.7.87]

Predicted SEED Role

"TsaC protein (YrdC domain) required for threonylcarbamoyladenosine t(6)A37 modification in tRNA"

MetaCyc Pathways

• N⁶-L-threonylcarbamoyladenosine³⁷-modified tRNA biosynthesis (2/2 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.87

Protein Sequence (190 amino acids)

>LRK54_RS10155 Sua5/YciO/YrdC/YwlC family protein (Rhodanobacter denitrificans FW104-10B01)
MLQRFTLAELDAAAALLHGGGVLAYPTEAVFGLGCDPHDRVAFEKIFALKQRPATQGVLL
IAADFAQVERYIELAAVPAEVLREVRSSWPGPHTWIFPRSAEVPAWVAGAHAGIALRVTA
HAPAAALCRAFGGALVSTSANPHGQPPARTAQTVAEYFGDALDGLLDAPLGGQASPTVIR
DALSGAIIRA