Protein Info for LRK54_RS10115 in Rhodanobacter denitrificans FW104-10B01

Annotation: O-antigen ligase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 416 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 35 to 51 (17 residues), see Phobius details amino acids 58 to 77 (20 residues), see Phobius details amino acids 88 to 105 (18 residues), see Phobius details amino acids 112 to 132 (21 residues), see Phobius details amino acids 147 to 166 (20 residues), see Phobius details amino acids 177 to 194 (18 residues), see Phobius details amino acids 200 to 216 (17 residues), see Phobius details amino acids 224 to 243 (20 residues), see Phobius details amino acids 330 to 351 (22 residues), see Phobius details amino acids 362 to 386 (25 residues), see Phobius details amino acids 393 to 409 (17 residues), see Phobius details PF04932: Wzy_C" amino acids 183 to 341 (159 residues), 79.7 bits, see alignment E=9.9e-27

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (416 amino acids)

>LRK54_RS10115 O-antigen ligase family protein (Rhodanobacter denitrificans FW104-10B01)
MRAHPASWQLWTASLLLAVMPLCFAVSGRFKSLPMALLFVTGVVLLATRAESRQAWRLAW
PVIAVCMLRLLYDIGNFLSHRLDWSTLDLPAQTLLFLGIAAVFTLPLKQRVIALGFSLTA
VLLGAASLYQRYALGVDRPYGLNGGDWAAVEFAMYLLVLVLLAMLQALRPDTRRGDRWLH
VAAVAVGLYGAVLTQSRGPLLSFAPVYLGLMLWHAMRSRHWRRVLVLFAATVLGMLAVTA
TLHRELVERLTDVPAEIASYDTGGDSNGSAVGERLEMWRTAWQAFSEHPLAGIGLDQFGV
YVREQAAAGNASPLIAKYVHPHSEYLESMVAGGLPALLVLLLFLAVPLGFFARQLGHPRE
PVAAAAAAGVMVIGMYALCAFGDNVFYRAMPQSLYLFLVLGLAVGIGRLQRNAPSC