Protein Info for LRK54_RS10010 in Rhodanobacter denitrificans FW104-10B01

Annotation: type II secretion system secretin GspD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 777 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details TIGR02517: type II secretion system protein D" amino acids 98 to 754 (657 residues), 474.3 bits, see alignment E=2.9e-146 PF21305: type_II_gspD_N0" amino acids 99 to 166 (68 residues), 34.8 bits, see alignment E=1.8e-12 PF03958: Secretin_N" amino acids 195 to 253 (59 residues), 45.5 bits, see alignment 1.1e-15 amino acids 260 to 326 (67 residues), 36.9 bits, see alignment E=5.1e-13 amino acids 334 to 500 (167 residues), 33.8 bits, see alignment E=4.9e-12 PF00263: Secretin" amino acids 580 to 745 (166 residues), 167.7 bits, see alignment E=2.8e-53

Best Hits

Predicted SEED Role

"General secretion pathway protein D"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (777 amino acids)

>LRK54_RS10010 type II secretion system secretin GspD (Rhodanobacter denitrificans FW104-10B01)
MSRMLIQQVLRSATLALAVGLVASCASLPQPHDDGALQREAIAGTQNPVPAPLPLNSGSA
SRGTAATTELSHGSGQFIRPGALIAPRPAAGGNGAVTFNFENQPVQAVVKAILGDLLKQN
YTIVPGVQGNISFATAEPVDASQALPILETLLSWTGNALVHRDGGYVVMPQKDAVAGNLV
PSLGASAPAGGLQARLFPLHYISASEMQKLIKPFARPDATLLVDPARNLLVMSGTPQELA
NYQSMVRTFDVDWLRGMSVGVFNLQYANVGELMPKLDAMFGEHGNTPLAGMLRFIPIERT
NALVVISTQSDYLQEVGDWIARIDRGGGNEPQLFVYDVRNIKASDLARYLAQIYTNGAGS
GGGDSGGQVGPGLAGATLGSAENAGATSMGSTAGSFGNPADASRGGGQVNANAGGGFGAS
GGGRDGGAAAGGSFGSGSAGFGSYPAAGGGSSAASEPQYSSSDGSVRISSVDGSNQLLVR
ARPSQWEEIKGAIGKLDNVPLQVQIETRILEVNLTGEFQFGVQWYLEGLTGSTTDSSGNI
IPGQPYRHRQLGLGQGGNAFRGEPFFYSFLNSDLQVAVRAMETSGNTKTLSAPSMVVMNN
QVASIAVGNQIPINQTSVNTGIGTTTSYSQVSYLNTGVILNVQPRINPGGLVYMNISQEV
SQADRSVPLVNGNPAISQRKLATQVAVQSGQTVLLGGLIEQAEGNTDTGIPGLNRVPVLG
RLFGNTSRSRNRTELIVLITPRVIRGGADAKQITDDYQSKFESLAPLRAPARADSKP