Protein Info for LRK54_RS09930 in Rhodanobacter denitrificans FW104-10B01

Annotation: LysR substrate-binding domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF00126: HTH_1" amino acids 8 to 64 (57 residues), 66.3 bits, see alignment E=2e-22 PF03466: LysR_substrate" amino acids 90 to 288 (199 residues), 118.1 bits, see alignment E=3.7e-38

Best Hits

KEGG orthology group: None (inferred from 54% identity to smt:Smal_3637)

Predicted SEED Role

"Glycine cleavage system transcriptional activator" in subsystem Orphan regulatory proteins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (306 amino acids)

>LRK54_RS09930 LysR substrate-binding domain-containing protein (Rhodanobacter denitrificans FW104-10B01)
MGKLPLGLLQQFVLVARLGNLSRAAAQANLTVSALSHQMRQLEERLERRLFERGPRGVKL
TAEGCVLLEAVGMHFDGIEHALAGYRTRHHDALTLSASPGIMSSWLVPRLPRLVAAHPEL
ELSLQSGSTLVDFEREPVDVALRYGRGEWAGLHSERLFGEWIAPVAAPALIARMDGADPR
ELSRWPLLGEPNPSRRWSDWFGRSGGTPPTRYVAQFDSLDALRHAALEGLGVALGRMVTS
KSLIDAGRLEVLGDNYLAVEEAYWLVYPPRSLEHRGLQLFRDWLLAEADDYRRQMSAFRP
DDKPVG