Protein Info for LRK54_RS09840 in Rhodanobacter denitrificans FW104-10B01

Annotation: efflux RND transporter periplasmic adaptor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 413 signal peptide" amino acids 1 to 39 (39 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 54 to 383 (330 residues), 277.2 bits, see alignment E=7.8e-87 PF16576: HlyD_D23" amino acids 71 to 301 (231 residues), 49.7 bits, see alignment E=4.5e-17 PF13533: Biotin_lipoyl_2" amino acids 79 to 125 (47 residues), 46.8 bits, see alignment 3.1e-16

Best Hits

Swiss-Prot: 42% identical to MDTA_PANAA: Multidrug resistance protein MdtA (mdtA) from Pantoea ananatis (strain AJ13355)

KEGG orthology group: None (inferred from 59% identity to smt:Smal_3689)

Predicted SEED Role

"Probable Co/Zn/Cd efflux system membrane fusion protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (413 amino acids)

>LRK54_RS09840 efflux RND transporter periplasmic adaptor subunit (Rhodanobacter denitrificans FW104-10B01)
MSRFWKIALIVVAVIVVAAVGFRLLHKPVPAGSAPASAAAKNKDGKDETPPVPVTVVPVV
KQNVPVYLTALGTVQALNTVTVNPQVGGQLLSLEFTEGQPVKKGQLLAQIDPRTYQAAYD
QAAAKQRQDQALLETAKSNLTRSQDLAAKGYISRQDLDTLRNTAAQYEAAVAADAANVRD
SQVQLNYTRVLSPIDGLAGIRAVDPGNVVTTASAIVTLTQLHPINVMFTLPEQNLDMVRR
AAAKDGTGLQVTALDRTDAHPIANGGVLKVVDNQIDTSTGTFRLKSEFPNANNELWPGQF
VNVRLLVNTVDGGLVIPAQAVQRGPDGDYVYQVQADSTVKMRPVTVAGEVGDSHVMIGNG
LQAGERVVTEGQFRLKPGSKVNALKPGEVPAAPTAAELEKAKQNSKGGGRRRG