Protein Info for LRK54_RS09760 in Rhodanobacter denitrificans FW104-10B01

Annotation: 3-oxoacyl-ACP reductase FabG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 10 to 198 (189 residues), 162.1 bits, E=2.4e-51
• PF01370: Epimerase
  • amino acids 10 to 101 (92 residues), 24.4 bits, E=3.6e-09
• PF08659: KR
  • amino acids 11 to 188 (178 residues), 76.1 bits, E=6.9e-25
• PF13561: adh_short_C2
  • amino acids 19 to 244 (226 residues), 172.9 bits, E=1.7e-54

Best Hits

Swiss-Prot: 43% identical to FABG_VIBCH: 3-oxoacyl-[acyl-carrier-protein] reductase FabG (fabG) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K00059, 3-oxoacyl-[acyl-carrier protein] reductase [EC: 1.1.1.100] (inferred from 77% identity to psu:Psesu_2788)

MetaCyc: 34% identical to 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl-CoA reductase (Mycobacterium tuberculosis H37Rv)
3-beta-hydroxy-Delta(5)-steroid dehydrogenase. [EC: 1.1.1.145]; 1.1.1.- [EC: 1.1.1.145]

Predicted SEED Role

"3-oxoacyl-[ACP] reductase (EC 1.1.1.100)" (EC 1.1.1.100)

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (49/53 steps found)
• superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
• palmitate biosynthesis II (type II fatty acid synthase) (29/31 steps found)
• superpathway of unsaturated fatty acids biosynthesis (E. coli) (18/20 steps found)
• biotin biosynthesis I (14/15 steps found)
• oleate biosynthesis IV (anaerobic) (13/14 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (14/16 steps found)
• 8-amino-7-oxononanoate biosynthesis I (10/11 steps found)
• (5Z)-dodecenoate biosynthesis I (6/6 steps found)
• palmitoleate biosynthesis I (from (5Z)-dodec-5-enoate) (8/9 steps found)
• gondoate biosynthesis (anaerobic) (4/4 steps found)
• (5Z)-dodecenoate biosynthesis II (5/6 steps found)
• stearate biosynthesis II (bacteria and plants) (5/6 steps found)
• 8-amino-7-oxononanoate biosynthesis IV (4/5 steps found)
• cis-vaccenate biosynthesis (4/5 steps found)
• fatty acid elongation -- saturated (4/5 steps found)
• octanoyl-[acyl-carrier protein] biosynthesis (mitochondria, yeast) (9/12 steps found)
• palmitate biosynthesis III (21/29 steps found)
• stearate biosynthesis IV (4/6 steps found)
• anteiso-branched-chain fatty acid biosynthesis (24/34 steps found)
• even iso-branched-chain fatty acid biosynthesis (24/34 steps found)
• odd iso-branched-chain fatty acid biosynthesis (24/34 steps found)
• tetradecanoate biosynthesis (mitochondria) (17/25 steps found)
• petroselinate biosynthesis (2/6 steps found)
• 2-allylmalonyl-CoA biosynthesis (2/8 steps found)
• streptorubin B biosynthesis (20/34 steps found)
• androstenedione degradation I (aerobic) (8/25 steps found)
• sitosterol degradation to androstenedione (1/18 steps found)
• superpathway of testosterone and androsterone degradation (8/28 steps found)
• androstenedione degradation II (anaerobic) (6/27 steps found)
• cholesterol degradation to androstenedione II (cholesterol dehydrogenase) (2/22 steps found)
• superpathway of cholesterol degradation I (cholesterol oxidase) (10/42 steps found)
• superpathway of cholesterol degradation II (cholesterol dehydrogenase) (10/47 steps found)
• superpathway of cholesterol degradation III (oxidase) (6/49 steps found)
• mycolate biosynthesis (20/205 steps found)
• superpathway of mycolate biosynthesis (21/239 steps found)

KEGG Metabolic Maps

• Androgen and estrogen metabolism
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Biosynthesis of unsaturated fatty acids
• C21-Steroid hormone metabolism
• Fatty acid biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100 or 1.1.1.145

Protein Sequence (245 amino acids)

>LRK54_RS09760 3-oxoacyl-ACP reductase FabG (Rhodanobacter denitrificans FW104-10B01)
MSEAHPARRALVTGGSGELGGAICHALAAAGWHVIVHGHHSLTRAEETAVAIVADGGSAQ
ALAFDVTDAEVTRAALDALLAEGPIHALVNNAGIHDDAPMAGMSDEQWHRVIDVSLHGFF
HVTRPLLLPMARARFGRIVSIGSAAAQLGNRGQTNYAAAKAALVGASKSLAREMASRGIT
VNVVAPGVIEGRMVEAAFPPERIRELVPAQRAGRPEEVAALVAFLCSDAAGYVNGQLIGV
NGGMG