Protein Info for LRK54_RS09520 in Rhodanobacter denitrificans FW104-10B01

Annotation: DUF692 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 288 PF05114: DUF692" amino acids 16 to 279 (264 residues), 360.4 bits, see alignment E=2.5e-112

Best Hits

Swiss-Prot: 51% identical to Y1558_ANADF: UPF0276 protein Anae109_1558 (Anae109_1558) from Anaeromyxobacter sp. (strain Fw109-5)

KEGG orthology group: K09930, hypothetical protein (inferred from 53% identity to reh:H16_A1821)

Predicted SEED Role

"Uncharacterized protein conserved in bacteria, NMA0228-like"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (288 amino acids)

>LRK54_RS09520 DUF692 domain-containing protein (Rhodanobacter denitrificans FW104-10B01)
MNPVLPFVQRPVPAAAGIGLRAPHIERVLAERPPVAWFEVHSENYFGAGGAMHAALERIR
ADYPLSLHGVGLSLGSADALDQAHLATLRRLVDRYEPALVSDHICWGAFGGAHMNELLPL
PFTEEALALMVSRVSQVQEALGREFLVENVSSYLGFRDADMPESAFVAELVRRSGCGLLL
DVNNIYVNSINHGFDPHDYLRAMPHASVREMHLAGFIRKGHLPVPLLIDSHSRPVADEVW
ALYGEALELCGAQPTLIEWDQDIPELEVLLAEAGRAEERLHACRTAIA