Protein Info for LRK54_RS09210 in Rhodanobacter denitrificans FW104-10B01

Annotation: anhydro-N-acetylmuramic acid kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03702: AnmK
  • amino acids 7 to 369 (363 residues), 485.5 bits, E=5.6e-150

Best Hits

Swiss-Prot: 58% identical to ANMK_XANOM: Anhydro-N-acetylmuramic acid kinase (anmK) from Xanthomonas oryzae pv. oryzae (strain MAFF 311018)

KEGG orthology group: K09001, anhydro-N-acetylmuramic acid kinase [EC: 2.7.1.-] (inferred from 55% identity to xal:XALc_0381)

Predicted SEED Role

"Anhydro-N-acetylmuramic acid kinase (EC 2.7.1.-)" (EC 2.7.1.-)

KEGG Metabolic Maps

• Lipopolysaccharide biosynthesis
• Nicotinate and nicotinamide metabolism
• Pentose phosphate pathway

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.-

Use Curated BLAST to search for 2.7.1.-

Protein Sequence (376 amino acids)

>LRK54_RS09210 anhydro-N-acetylmuramic acid kinase (Rhodanobacter denitrificans FW104-10B01)
MDDASALYIGLISGTSADGIDAVLAGFKRGVPQLHASHSHPWPEDLRKRMLALAQGEATL
DLDAFGRLDVQIGHCFADAALQLLERSSTPATRVRAIGSHGQTLRHRPAGAYPFTLQLGD
PSVIAERCGIDVVADFRRTDVAAGGQGAPLLPALHAMLLARPGHTRVVLNLGGIANITVL
GVDGRVLGFDTGPANGLLDAWCLRQRGEPFDRDGAYAAAGRLDPNLLDTLLADPYFALPP
PKSTGREYFHLDWLSAHAPLAALDPADVQATLLELTARSVALAIAQHAPDANEVLACGGG
VHNTALMRRLSVLLAPRVLQGTSRYGIDPDFLEATAFAWLARQRLLGLPGNLPAVTGARG
PRVLGAIYSAPTVRPA