Protein Info for LRK54_RS08315 in Rhodanobacter denitrificans FW104-10B01

Annotation: Lrp/AsnC family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 158 PF13412: HTH_24" amino acids 4 to 51 (48 residues), 67.4 bits, see alignment E=1.3e-22 PF13404: HTH_AsnC-type" amino acids 4 to 45 (42 residues), 60.4 bits, see alignment E=2.2e-20 PF01047: MarR" amino acids 5 to 46 (42 residues), 24.7 bits, see alignment E=3.4e-09 PF01037: AsnC_trans_reg" amino acids 70 to 144 (75 residues), 77.2 bits, see alignment E=1.5e-25

Best Hits

Swiss-Prot: 38% identical to GRP_ZYMMA: Glutamate uptake regulatory protein (grp) from Zymomonas mobilis subsp. mobilis (strain ATCC 10988 / DSM 424 / LMG 404 / NCIMB 8938 / NRRL B-806 / ZM1)

KEGG orthology group: K03719, Lrp/AsnC family transcriptional regulator, leucine-responsive regulatory protein (inferred from 77% identity to psu:Psesu_0043)

Predicted SEED Role

"Transcriptional regulator, AsnC family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (158 amino acids)

>LRK54_RS08315 Lrp/AsnC family transcriptional regulator (Rhodanobacter denitrificans FW104-10B01)
MTTLDRTDLRILAVLQSEGRITNAELAERVSLSPSACLRRLQRLEADRVITGYAAQVDPQ
AVGLGLQAFVRVQLVKHESAAIEGFVERVNGWDEVVACHALTGDMDYLLHVYVADLKDFS
RFLLDHLLNAAGVADVNSSFVLRTVKRSPSLPLAQLER