Protein Info for LRK54_RS07965 in Rhodanobacter denitrificans FW104-10B01

Annotation: decarboxylating 6-phosphogluconate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 TIGR00872: 6-phosphogluconate dehydrogenase (decarboxylating)" amino acids 1 to 300 (300 residues), 388 bits, see alignment E=1.4e-120 PF03446: NAD_binding_2" amino acids 3 to 154 (152 residues), 141.8 bits, see alignment E=4.1e-45 PF00393: 6PGD" amino acids 169 to 279 (111 residues), 75.9 bits, see alignment E=7.5e-25

Best Hits

Swiss-Prot: 45% identical to YQEC_BACSU: Putative 6-phosphogluconate dehydrogenase YqeC (yqeC) from Bacillus subtilis (strain 168)

KEGG orthology group: K00033, 6-phosphogluconate dehydrogenase [EC: 1.1.1.44] (inferred from 70% identity to xal:XALc_0826)

Predicted SEED Role

"6-phosphogluconate dehydrogenase, decarboxylating (EC 1.1.1.44)" in subsystem Pentose phosphate pathway (EC 1.1.1.44)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.44

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (301 amino acids)

>LRK54_RS07965 decarboxylating 6-phosphogluconate dehydrogenase (Rhodanobacter denitrificans FW104-10B01)
MELGMVGLGRMGANMAERLVKGGHKVAGFDPSADARQAAAAHGIAPATSLAALVAALPAP
RVLWLMVPAGKITDDTVDALLPLLAKGDTVIDGGNSNYKDTLRRAQRYAEHGLGYVDCGT
SGGVWGLKEGYSMMIGGDEKAVEALRPIFETLAPAKDQGWGHVGPAGAGHYTKMVHNGIE
YGMMQAYAEGFSILKHKQEFGLDLHQVGEIWRTGSVVRSWLLDLATDALGKNPNLDGIAP
YVVDSGEGRWTVNAALELNVSAPVITLSLMERFRSRDSDSFADKLLASLRNEFGGHAIKK
E