Protein Info for LRK54_RS07945 in Rhodanobacter denitrificans FW104-10B01

Annotation: LytTR family DNA-binding domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00072: Response_reg
  • amino acids 3 to 111 (109 residues), 91.4 bits, E=4.4e-30
• PF04397: LytTR
  • amino acids 137 to 231 (95 residues), 50.8 bits, E=1.7e-17

Best Hits

KEGG orthology group: K08083, two-component system, LytT family, response regulator AlgR (inferred from 50% identity to smt:Smal_3531)

Predicted SEED Role

"Autolysis response regulater LytR" in subsystem Murein hydrolase regulation and cell death

Protein Sequence (234 amino acids)

>LRK54_RS07945 LytTR family DNA-binding domain-containing protein (Rhodanobacter denitrificans FW104-10B01)
MRVLVVDDEPLARARLAALLGDCAGVEVVGNVGDGEAALAALGELQPDALLLDINMPGID
GVALAQRLAGRTRPQVIFCTAYEAHALKAFELGAADYLLKPVRLDRLREALQRAQRRLAD
APREPAAYLYGRLRGEQVRIALDEVICLLAEEKYVVVQHRRGELLIEDSLRQLEEAYPDQ
LIRLHRNCLVPPPRLLGLKTLADGRVLARLDGSELNPEISRRNLPAVRKLLRLG