Protein Info for LRK54_RS07590 in Rhodanobacter denitrificans FW104-10B01

Annotation: Na+/H+ antiporter subunit C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00420: Oxidored_q2
  • amino acids 6 to 105 (100 residues), 72.7 bits, E=8.9e-25

Best Hits

Swiss-Prot: 71% identical to PHAC1_RHIME: Probable K(+)/H(+) antiporter subunit C (phaC) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K05560, multicomponent K+:H+ antiporter subunit C (inferred from 79% identity to pzu:PHZ_c2144)

Predicted SEED Role

"Na(+) H(+) antiporter subunit C" in subsystem Sodium Hydrogen Antiporter

Protein Sequence (111 amino acids)

>LRK54_RS07590 Na+/H+ antiporter subunit C (Rhodanobacter denitrificans FW104-10B01)
MELVLAAAIGILAASGVWLLLRPRTFQVIIGLTLISYAVNLFIFSIGGLRTGADPVLHGG
DIAQYADPLPQALVLTAIVIGFATTALFLVVLLTSRGLTGNDHVDGEDGTP