Protein Info for LRK54_RS07520 in Rhodanobacter denitrificans FW104-10B01

Annotation: fatty acid desaturase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 transmembrane" amino acids 27 to 46 (20 residues), see Phobius details amino acids 51 to 71 (21 residues), see Phobius details amino acids 166 to 187 (22 residues), see Phobius details amino acids 199 to 220 (22 residues), see Phobius details amino acids 277 to 289 (13 residues), see Phobius details PF00487: FA_desaturase" amino acids 51 to 274 (224 residues), 81.6 bits, see alignment E=4e-27

Best Hits

KEGG orthology group: K00507, stearoyl-CoA desaturase (delta-9 desaturase) [EC: 1.14.19.1] (inferred from 73% identity to xal:XALc_2495)

Predicted SEED Role

"Fatty acid desaturase (EC 1.14.19.1); Delta-9 fatty acid desaturase (EC 1.14.19.1)" (EC 1.14.19.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.19.1

Use Curated BLAST to search for 1.14.19.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (302 amino acids)

>LRK54_RS07520 fatty acid desaturase (Rhodanobacter denitrificans FW104-10B01)
MRTARRWFDTSAVVEVDEAREDRIDWLRAAPFVAMHLACLGVIWVGVSPVALAVAVALYA
LRMFALTGFYHRYFSHRTFQTSRAVQFVFATIGASCVQRGPLWWAAHHRHHHRVTDTPAD
PHSPGVHGFLWSHVGWFLTPRNFRTDLARVPDLAKYPELRWLDRFDIVIPLLLAIGMYAL
GALLQHVAPQLGTSGGQMLVWGFFVSTIVLFHATVTINSLAHRYGRRRFETKDDSRNNLW
LALLTFGEGWHNNHHFFPGSSRQGFRWWEVDLTWYGLKLMAMLGLVRGLKPVPAWVLARA
RS