Protein Info for LRK54_RS07470 in Rhodanobacter denitrificans FW104-10B01

Annotation: succinate dehydrogenase, hydrophobic membrane anchor protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 135 transmembrane" amino acids 34 to 57 (24 residues), see Phobius details amino acids 69 to 93 (25 residues), see Phobius details amino acids 109 to 132 (24 residues), see Phobius details PF01127: Sdh_cyt" amino acids 11 to 112 (102 residues), 58.5 bits, see alignment E=7.4e-20 TIGR02968: succinate dehydrogenase, hydrophobic membrane anchor protein" amino acids 24 to 126 (103 residues), 75.1 bits, see alignment E=2.2e-25

Best Hits

Swiss-Prot: 31% identical to DHSD_RICBR: Succinate dehydrogenase hydrophobic membrane anchor subunit (sdhD) from Rickettsia bellii (strain RML369-C)

KEGG orthology group: K00242, succinate dehydrogenase hydrophobic membrane anchor protein (inferred from 64% identity to put:PT7_2482)

Predicted SEED Role

"Succinate dehydrogenase hydrophobic membrane anchor protein" in subsystem Succinate dehydrogenase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (135 amino acids)

>LRK54_RS07470 succinate dehydrogenase, hydrophobic membrane anchor protein (Rhodanobacter denitrificans FW104-10B01)
MSEFPGQSGMRDPLKTARHWGPSRTGVQHWWVQRLTAVALIPLTLWFLFFVAGLLHADYD
AVLASIGQPVHAFLLIVLTVCSYWHGMLGLDVIIGDYVHARGQEVTLQIALRFGALLGAL
ATILAVLAVWFTRLH