Protein Info for LRK54_RS07365 in Rhodanobacter denitrificans FW104-10B01

Annotation: sigma 54-interacting transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 617 PF06506: PrpR_N" amino acids 35 to 192 (158 residues), 113.6 bits, see alignment E=2.4e-36 PF00158: Sigma54_activat" amino acids 308 to 473 (166 residues), 195.2 bits, see alignment E=2.1e-61 PF14532: Sigma54_activ_2" amino acids 309 to 478 (170 residues), 55.3 bits, see alignment E=2.6e-18 PF07728: AAA_5" amino acids 330 to 448 (119 residues), 29.4 bits, see alignment E=2.2e-10 PF00004: AAA" amino acids 330 to 463 (134 residues), 24.6 bits, see alignment E=9e-09 PF02954: HTH_8" amino acids 574 to 613 (40 residues), 36.6 bits, see alignment 9.2e-13

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (617 amino acids)

>LRK54_RS07365 sigma 54-interacting transcriptional regulator (Rhodanobacter denitrificans FW104-10B01)
MNFVTASRNQPRICVVGNSKFTQVIHSLVDEFKNVAQITVIDNVFNDAVRAARELIDTQQ
VDFFVSAGANAFYLKDTLSVPVLGLRVSSEDLIRAVLTARLISRRILLLTYERQETNLDL
LKIFDDIEVLHCTYTTAEEIKEVFHQHRSEGYGVVIGSSYACDLADQWGIGSVLIYSRSS
CRNLLRKATLLAGQNARQLQKDSLLQFALDSNPCPTVITTQGNEVVAWNSAALTQIPHFA
QRRRLNGLLDKHACNALRLQAEQLLIDGHPCTLNKEPFDLSDGTPAAVYRFQFSRAGELR
SDGRRLVSSSQCMAEVQNLLSVYGVNVDIVLLYGETGTGKELAARTVHAASDHASGPFIA
VNCSAIPVDLFESELFGYMDGAFTGARSGGRTGLLETANGGSFFLDEINALTLAHQAKLL
RVLQEKEMTPVGARKPVALDIKFIAACNVDLAEETRAGRFREDLYYRINTFAVRMPALRE
RPEDIVALTSYMVHRAVARYRANIDIDVLVNGLVPRFKGYHWPGNVRQLENIVDRLVVAS
NLHHGSAAIVAALPRLAPEIYAHADNDDAARGHLKALELEEISRVLKMFGGRRNESADYL
GISPTTLWRRLKQNRVN