Protein Info for LRK54_RS06955 in Rhodanobacter denitrificans FW104-10B01

Annotation: ATP-binding cassette domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 244 PF00005: ABC_tran" amino acids 18 to 161 (144 residues), 102.7 bits, see alignment E=2.6e-33

Best Hits

Swiss-Prot: 46% identical to NATA_BACSU: ABC transporter ATP-binding protein NatA (natA) from Bacillus subtilis (strain 168)

KEGG orthology group: K09697, sodium transport system ATP-binding protein (inferred from 76% identity to xcv:XCV4144)

MetaCyc: 46% identical to Na+ ABC efflux transporter ATP-binding protein (Bacillus subtilis subtilis 168)
RXN-17739 [EC: 7.2.2.3, 7.2.2.4]

Predicted SEED Role

"ABC-type Na+ transport system, ATPase component"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.2.2.3 or 7.2.2.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (244 amino acids)

>LRK54_RS06955 ATP-binding cassette domain-containing protein (Rhodanobacter denitrificans FW104-10B01)
MIEVRDLHKAFGTVKAVDGVSFSARDGEITGLLGPNGAGKTTTLRMLYTLMTPDRGQVLV
DGIDAAVDPLGVRRRLGVLPDARGLYKRLSARENIDYFGRLHGLPEELLASRREALVKAL
EMDDIADRRTEGFSQGQRVKTAIARALVHDPRNVILDEPTNGLDVMATRALRQFMRRLKD
EGRCVLFSSHIMQEVAALCDRIVVIAHGRVVADESPDALRAQTGESNLEDAFVKIIGSEE
GLAA