Protein Info for LRK54_RS06940 in Rhodanobacter denitrificans FW104-10B01

Annotation: GTP cyclohydrolase I FolE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01227: GTP_cyclohydroI
  • amino acids 16 to 193 (178 residues), 252.8 bits, E=7.4e-80
• TIGR00063: GTP cyclohydrolase I
  • amino acids 16 to 193 (178 residues), 225 bits, E=2.4e-71

Best Hits

Swiss-Prot: 75% identical to GCH1_XANC5: GTP cyclohydrolase 1 (folE) from Xanthomonas campestris pv. vesicatoria (strain 85-10)

KEGG orthology group: K01495, GTP cyclohydrolase I [EC: 3.5.4.16] (inferred from 78% identity to sml:Smlt4659)

MetaCyc: 52% identical to GTP cyclohydrolase I (Bacillus subtilis subtilis 168)
GTP cyclohydrolase I. [EC: 3.5.4.16]

Predicted SEED Role

"GTP cyclohydrolase I (EC 3.5.4.16) type 1" in subsystem Folate Biosynthesis or Molybdenum cofactor biosynthesis or Pterin biosynthesis or Queuosine-Archaeosine Biosynthesis (EC 3.5.4.16)

MetaCyc Pathways

• superpathway of tetrahydrofolate biosynthesis and salvage (10/12 steps found)
• superpathway of tetrahydrofolate biosynthesis (8/10 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis IV (Plasmodium) (2/3 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis I (3/5 steps found)
• erythro-tetrahydrobiopterin biosynthesis I (2/4 steps found)
• threo-tetrahydrobiopterin biosynthesis (2/4 steps found)
• preQ₀ biosynthesis (2/4 steps found)
• drosopterin and aurodrosopterin biosynthesis (4/7 steps found)
• tetrahydromonapterin biosynthesis (1/4 steps found)
• superpathway of chorismate metabolism (40/59 steps found)

KEGG Metabolic Maps

• Folate biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.5.4.16

Use Curated BLAST to search for 3.5.4.16

Protein Sequence (200 amino acids)

>LRK54_RS06940 GTP cyclohydrolase I FolE (Rhodanobacter denitrificans FW104-10B01)
MSEQRHPNDVSQEQAEEAVRTLLRWAGEDPSREGLLDTPKRVVKAYRDWFAGYDSDPGDY
LRRTFKEVNGYDEMVVLRDIEFESHCEHHMAPIIGRAHVGYLPTNRVVGISKLARVVDGF
ARRFQVQEKLTAQIAQCIQETLQPAGVAVVVDASHECMTTRGVHKRGVSMVTSQMLGTFR
DDARTRAEFLQFIGIHGGHR